Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D Protein X (X)

Recombinant Hepatitis B virus genotype D Protein X (X) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D) . Target Name: X. Target Synonyms: HBxPeptide XpX. Accession Number: O93195. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Hepatitis B virus genotype D Protein X (X) is a purified Recombinant Protein.

Accession Number

O93195

Expression Region

1~154aa

Host

E. coli

Target

X

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HBxPeptide XpX

Species

Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)

Protein Name

Recombinant Protein

AA Sequence

MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PSCA Antibody Picoband® (HRP Conjugate)
PB9351-HRP 100 µg/Vial

Anti-PSCA Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Rabbit anti-SND1 Antibody
MBS4505607-01 0.05 mL

Rabbit anti-SND1 Antibody

Sign In for Pricing
View Details
Rabbit anti-SND1 Antibody
MBS4505607-02 0.1 mL

Rabbit anti-SND1 Antibody

Sign In for Pricing
View Details
Rabbit anti-SND1 Antibody
MBS4505607-03 5x 0.1 mL

Rabbit anti-SND1 Antibody

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to AluMin (ALB)
MBS2149554-01 0.1 mL

PE-Linked Polyclonal Antibody to AluMin (ALB)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to AluMin (ALB)
MBS2149554-02 0.2 mL

PE-Linked Polyclonal Antibody to AluMin (ALB)

Sign In for Pricing
View Details