Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Recombinant Rotavirus A Outer capsid glycoprotein VP7 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A) . Target Name: Rotavirus A Outer capsid glycoprotein VP7. Target Synonyms: Outer capsid glycoprotein VP7; Fragment. Accession Number: A8D8S8. Expression Region: 34~309aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rotavirus A Outer capsid glycoprotein VP7 is a purified Recombinant Protein.

Accession Number

A8D8S8

Expression Region

34~309aa

Host

E. coli

Target

Rotavirus A Outer capsid glycoprotein VP7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer capsid glycoprotein VP7; Fragment

Species

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A)

Protein Name

Recombinant Protein

AA Sequence

QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)
MBS1077953-01 0.02 mg (E-Coli)

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)

Sign In for Pricing
View Details
Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)
MBS1077953-02 0.02 mg (Yeast)

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)

Sign In for Pricing
View Details
Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)
MBS1077953-03 0.1 mg (E-Coli)

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)

Sign In for Pricing
View Details
Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)
MBS1077953-04 0.1 mg (Yeast)

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)

Sign In for Pricing
View Details
Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)
MBS1077953-05 0.02 mg (Baculovirus)

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)

Sign In for Pricing
View Details
Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)
MBS1077953-06 0.02 mg (Mammalian-Cell)

Recombinant Rat Formimidoyltransferase-cyclodeaminase (Ftcd)

Sign In for Pricing
View Details