Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Recombinant Rotavirus A Outer capsid glycoprotein VP7 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A) . Target Name: Rotavirus A Outer capsid glycoprotein VP7. Target Synonyms: Outer capsid glycoprotein VP7; Fragment. Accession Number: A8D8S8. Expression Region: 34~309aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rotavirus A Outer capsid glycoprotein VP7 is a purified Recombinant Protein.

Accession Number

A8D8S8

Expression Region

34~309aa

Host

E. coli

Target

Rotavirus A Outer capsid glycoprotein VP7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer capsid glycoprotein VP7; Fragment

Species

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A)

Protein Name

Recombinant Protein

AA Sequence

QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA5 AAV Vector (Rat) (CMV)
22368106 1 µg

GOLGA5 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
TSPAN17 Polyclonal Antibody
orb1416385 100 µL

TSPAN17 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)
MBS1221062-01 0.02 mg (E-Coli)

Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)
MBS1221062-02 0.1 mg (E-Coli)

Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)
MBS1221062-03 0.02 mg (Yeast)

Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)
MBS1221062-04 0.1 mg (Yeast)

Recombinant Porphyra yezoensis Porphyra yezoensis Thioredoxin (trxA)

Sign In for Pricing
View Details