Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 1 (M)

Recombinant Influenza A virus Matrix protein 1 (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/USA:Iowa/1943 H1N1) . Target Name: M. Target Synonyms: M; Matrix protein 1; M1. Accession Number: A4GCL0. Expression Region: 1~252aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Influenza A virus Matrix protein 1 (M) is a purified Recombinant Protein.

Accession Number

A4GCL0

Expression Region

1~252aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

M; Matrix protein 1; M1

Species

Influenza A virus (strain A/USA:Iowa/1943 H1N1)

Protein Name

Recombinant Protein

AA Sequence

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)
MBS6506366-01 0.2 mL

YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)

Sign In for Pricing
View Details
YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)
MBS6506366-02 5x 0.2 mL

YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)

Sign In for Pricing
View Details
DTYMK Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62649R-BF750-01 20 µL

DTYMK Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
DTYMK Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62649R-BF750-02 100 µL

DTYMK Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Anti-FGG Polyclonal Antibody
PHB99301 100 μg

Anti-FGG Polyclonal Antibody

Sign In for Pricing
View Details
Human KYNU qPCR Primer Pair
QH27485S 200 Tests

Human KYNU qPCR Primer Pair

Sign In for Pricing
View Details