Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 1 (M)

Recombinant Influenza A virus Matrix protein 1 (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/USA:Iowa/1943 H1N1) . Target Name: M. Target Synonyms: M; Matrix protein 1; M1. Accession Number: A4GCL0. Expression Region: 1~252aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Influenza A virus Matrix protein 1 (M) is a purified Recombinant Protein.

Accession Number

A4GCL0

Expression Region

1~252aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

M; Matrix protein 1; M1

Species

Influenza A virus (strain A/USA:Iowa/1943 H1N1)

Protein Name

Recombinant Protein

AA Sequence

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMF Rabbit mAb
MBS4761182-01 0.1 mL

TMF Rabbit mAb

Sign In for Pricing
View Details
TMF Rabbit mAb
MBS4761182-02 5x 0.1 mL

TMF Rabbit mAb

Sign In for Pricing
View Details
SuperKine™ Trypsin-EDTA Solution,0.25% (Without Phenol Red)
BMU110 100 mL

SuperKine™ Trypsin-EDTA Solution,0.25% (Without Phenol Red)

Sign In for Pricing
View Details
DAT-38-292-YL AB Labels
035427 Pack of 2500 Label(s)

DAT-38-292-YL AB Labels

Sign In for Pricing
View Details
HBG1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
23052156 3x 1.0 µg DNA

HBG1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
C3orf33 3'UTR Luciferase Stable Cell Line
TU002252 1.0 mL

C3orf33 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details