Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 1 (M)

Recombinant Influenza A virus Matrix protein 1 (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/USA:Iowa/1943 H1N1) . Target Name: M. Target Synonyms: M; Matrix protein 1; M1. Accession Number: A4GCL0. Expression Region: 1~252aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Influenza A virus Matrix protein 1 (M) is a purified Recombinant Protein.

Accession Number

A4GCL0

Expression Region

1~252aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

M; Matrix protein 1; M1

Species

Influenza A virus (strain A/USA:Iowa/1943 H1N1)

Protein Name

Recombinant Protein

AA Sequence

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mucin 1 (MUC1) ELISA Kit
orb2812315-01 48 Tests

Human Mucin 1 (MUC1) ELISA Kit

Sign In for Pricing
View Details
Human Mucin 1 (MUC1) ELISA Kit
orb2812315-02 96 Tests

Human Mucin 1 (MUC1) ELISA Kit

Sign In for Pricing
View Details
Human Mucin 1 (MUC1) ELISA Kit
orb2812315-03 5 x 96 T

Human Mucin 1 (MUC1) ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Major Basic Protein (MBP)
MBS2114595-01 0.1 mL

FITC-Linked Polyclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Major Basic Protein (MBP)
MBS2114595-02 0.2 mL

FITC-Linked Polyclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Major Basic Protein (MBP)
MBS2114595-03 0.5 mL

FITC-Linked Polyclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details