Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hevea brasiliensis Pro-hevein (HEV1)

Recombinant Hevea brasiliensis Pro-hevein (HEV1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis) . Target Name: HEV1. Target Synonyms: Major hevein. Accession Number: P02877. Expression Region: 18~204aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Hevea brasiliensis Pro-hevein (HEV1) is a purified Recombinant Protein.

Accession Number

P02877

Expression Region

18~204aa

Host

E. coli

Target

HEV1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major hevein

Species

Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

Protein Name

Recombinant Protein

AA Sequence

EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF740 conjugate, 0.1mg/mL
BNC741884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF405S conjugate, 0.1mg/mL
BNC040843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL
BNC401505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF740 conjugate, 0.1mg/mL
BNC741125-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details