Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA)

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: ppiA. Target Synonyms: Cyclophilin ARotamase A. Accession Number: P0AFL4. Expression Region: 25~190aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein.

Accession Number

P0AFL4

Expression Region

25~190aa

Host

E. coli

Target

PpiA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cyclophilin ARotamase A

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAND1 Blocking Peptide
MBS9619691-01 1 mg

SCAND1 Blocking Peptide

Sign In for Pricing
View Details
SCAND1 Blocking Peptide
MBS9619691-02 5x 1 mg

SCAND1 Blocking Peptide

Sign In for Pricing
View Details
Xlr3a Mouse shRNA Lentiviral Particle (Locus ID 22445)
TL502430V 500 µL Each

Xlr3a Mouse shRNA Lentiviral Particle (Locus ID 22445)

Sign In for Pricing
View Details
Rabbit Polyclonal Tollip Antibody [Janelia Fluor 549]
NBP1-76681JF549 0.1 mL

Rabbit Polyclonal Tollip Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
SATL1 Adenovirus (Rat)
43041056 1.0 mL

SATL1 Adenovirus (Rat)

Sign In for Pricing
View Details
Avibactam sodium dihydrate
MF-0050846-01 100 mg

Avibactam sodium dihydrate

Sign In for Pricing
View Details