Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA)

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: ppiA. Target Synonyms: Cyclophilin ARotamase A. Accession Number: P0AFL4. Expression Region: 25~190aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein.

Accession Number

P0AFL4

Expression Region

25~190aa

Host

E. coli

Target

PpiA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cyclophilin ARotamase A

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM1 Protein Vector (Rat) (pPB-C-His)
PV312534 500 ng

TPM1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PDPR, CT (PDPR, KIAA1990, Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial) (Biotin) discontinued
039855-Biotin 200 µL

PDPR, CT (PDPR, KIAA1990, Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial) (Biotin) discontinued

Sign In for Pricing
View Details
SYT7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2323107 1.0 µg DNA

SYT7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Bis (3,3-dimethyl-hept-2-yl) Phthalate
442840 10 mg

Bis (3,3-dimethyl-hept-2-yl) Phthalate

Sign In for Pricing
View Details
NOL7 Polyclonal Antibody
UB-GEN-5748 100 µL

NOL7 Polyclonal Antibody

Sign In for Pricing
View Details
MYBL2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1371304 1.0 µg DNA

MYBL2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details