Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA)

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: ppiA. Target Synonyms: Cyclophilin ARotamase A. Accession Number: P0AFL4. Expression Region: 25~190aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O6:H1 Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein.

Accession Number

P0AFL4

Expression Region

25~190aa

Host

E. coli

Target

PpiA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cyclophilin ARotamase A

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PR10A Antibody, FITC conjugated
A51856-50UG 50 µg

PR10A Antibody, FITC conjugated

Sign In for Pricing
View Details
Human SLCO2A1 qPCR Primer Pair
QH22905S 200 Tests

Human SLCO2A1 qPCR Primer Pair

Sign In for Pricing
View Details
Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT
E4201hu-01 48 Well

Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT

Sign In for Pricing
View Details
Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT
E4201hu-02 96 Well

Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT

Sign In for Pricing
View Details
Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT
E4201hu-03 5x 96 Tests

Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT

Sign In for Pricing
View Details
Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT
E4201hu-04 10x 96 Tests

Human Butyrophilin subfamily 1 member A1, BTN1A1 ELISA KIT

Sign In for Pricing
View Details