Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Crossover junction endodeoxyribonuclease RuvC (ruvC)

Recombinant E. coli Crossover junction endodeoxyribonuclease RuvC (ruvC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: ruvC. Target Synonyms: Holliday junction nuclease RuvCHolliday junction resolvase RuvC. Accession Number: P0A814. Expression Region: 2~173aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Crossover junction endodeoxyribonuclease RuvC (ruvC) is a purified Recombinant Protein.

Accession Number

P0A814

Expression Region

2~173aa

Host

E. coli

Target

RuvC

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Holliday junction nuclease RuvCHolliday junction resolvase RuvC

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Electron transfer flavoprotein subunit beta ELISA Kit
MBS2887227-01 48 Well

Rat Electron transfer flavoprotein subunit beta ELISA Kit

Sign In for Pricing
View Details
Rat Electron transfer flavoprotein subunit beta ELISA Kit
MBS2887227-02 96 Well

Rat Electron transfer flavoprotein subunit beta ELISA Kit

Sign In for Pricing
View Details
Rat Electron transfer flavoprotein subunit beta ELISA Kit
MBS2887227-03 5x 96 Well

Rat Electron transfer flavoprotein subunit beta ELISA Kit

Sign In for Pricing
View Details
Rat Electron transfer flavoprotein subunit beta ELISA Kit
MBS2887227-04 10x 96 Well

Rat Electron transfer flavoprotein subunit beta ELISA Kit

Sign In for Pricing
View Details
GBE1 Rabbit Polyclonal Antibody
E10G03451 100 µL

GBE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMP1 Mouse Monoclonal Antibody [Clone ID: LBI3E9]
AMM13470VCF 100 µg

BMP1 Mouse Monoclonal Antibody [Clone ID: LBI3E9]

Sign In for Pricing
View Details