Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51)

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: mpt51. Target Synonyms: mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen. Accession Number: P9WQN6. Expression Region: 27~299aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein.

Accession Number

P9WQN6

Expression Region

27~299aa

Host

E. coli

Target

Mpt51

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TOP1 sgRNA gene knockout kit - Lentiviral human TOP1 sgRNA gene knockout kit (plasmid)
GTR15371378 1 Vial

Lentiviral human TOP1 sgRNA gene knockout kit - Lentiviral human TOP1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri glgA Protein (aa 1-475) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9555-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Kluyveri glgA Protein (aa 1-475) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
NELF Double Nickase Plasmid (h2)
sc-408213-NIC-2 20 µg

NELF Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Goose Matrix Metalloproteinase 25 ELISA Kit
MBS053060 Inquire

Goose Matrix Metalloproteinase 25 ELISA Kit

Sign In for Pricing
View Details
CTDSP2 Mouse Monoclonal Antibody [Clone ID: LBI10G10]
AMM18539VCF 100 µg

CTDSP2 Mouse Monoclonal Antibody [Clone ID: LBI10G10]

Sign In for Pricing
View Details
Rabbit Polyclonal DDX41 Antibody [DyLight 550]
NBP2-99114R 0.1 mL

Rabbit Polyclonal DDX41 Antibody [DyLight 550]

Sign In for Pricing
View Details