Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51)

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: mpt51. Target Synonyms: mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen. Accession Number: P9WQN6. Expression Region: 27~299aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein.

Accession Number

P9WQN6

Expression Region

27~299aa

Host

E. coli

Target

Mpt51

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A930005I04Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3617607 1.0 µg DNA

A930005I04Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
BAF53A (ACTL6A) Human qPCR Template Standard (NM_004301)
HK200555 1 Kit

BAF53A (ACTL6A) Human qPCR Template Standard (NM_004301)

Sign In for Pricing
View Details
Mouse Mir8094 qPCR Primer Pair
QM81326S 200 Tests

Mouse Mir8094 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Patl1 Pre-designed siRNA Set A
SI110144A 1 Each

Mouse Patl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pdcd1lg2 (NM_001107582) Rat Tagged Lenti ORF Clone
RR210686L4 10 µg

Pdcd1lg2 (NM_001107582) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gm4945 3'UTR GFP Stable Cell Line
TU158137 1.0 mL

Gm4945 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details