Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51)

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: mpt51. Target Synonyms: mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen. Accession Number: P9WQN6. Expression Region: 27~299aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein.

Accession Number

P9WQN6

Expression Region

27~299aa

Host

E. coli

Target

Mpt51

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CCL6 (Chemokine C-C-Motif Ligand 6) ValidElisa Kit
EK343142 96 Well

Mouse CCL6 (Chemokine C-C-Motif Ligand 6) ValidElisa Kit

Sign In for Pricing
View Details
Mouse Monoclonal Carm1 Antibody (CARM1/7426) [Janelia Fluor 585]
NBP3-20909JF585 0.1 mL

Mouse Monoclonal Carm1 Antibody (CARM1/7426) [Janelia Fluor 585]

Sign In for Pricing
View Details
LAB Blocking Peptide
33R-6229 100 ug

LAB Blocking Peptide

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG H&L Antibody (ALP)
abx239384-01 100 µL

Goat Anti-Rabbit IgG H&L Antibody (ALP)

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG H&L Antibody (ALP)
abx239384-02 500 µL

Goat Anti-Rabbit IgG H&L Antibody (ALP)

Sign In for Pricing
View Details
Mouse Monoclonal Serine Dehydratase Antibody (OTI3D3) [CoraFluor 1]
NBP2-74074CL1 0.1 mL

Mouse Monoclonal Serine Dehydratase Antibody (OTI3D3) [CoraFluor 1]

Sign In for Pricing
View Details