Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51)

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: mpt51. Target Synonyms: mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen. Accession Number: P9WQN6. Expression Region: 27~299aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein.

Accession Number

P9WQN6

Expression Region

27~299aa

Host

E. coli

Target

Mpt51

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigen

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TBCC Antibody
NBP1-85679 0.1 mL

Rabbit Polyclonal TBCC Antibody

Sign In for Pricing
View Details
Rat Anti-Mouse CD45 mAb (AF647) [30-F11]
E2782271 100 Tests

Rat Anti-Mouse CD45 mAb (AF647) [30-F11]

Sign In for Pricing
View Details
MFluor™ Red 780 Anti-human CD55 Antibody *HI55a*
105500W1-AAT 500 Tests

MFluor™ Red 780 Anti-human CD55 Antibody *HI55a*

Sign In for Pricing
View Details
ERC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0690807 1.0 µg DNA

ERC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Tas2r137 Rat shRNA Plasmid (Locus ID 500089)
TL702890 1 Kit

Tas2r137 Rat shRNA Plasmid (Locus ID 500089)

Sign In for Pricing
View Details
C22ORF30 antibody
MBS5303484-01 0.1 mL

C22ORF30 antibody

Sign In for Pricing
View Details