Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Outer surface protein A (ospA)

Recombinant Borrelia burgdorferi Outer surface protein A (ospA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Borreliella burgdorferi (Lyme disease spirochete) (Borrelia burgdorferi) . Target Name: ospA. Target Synonyms: ospA; Outer surface protein A. Accession Number: P0A3N6. Expression Region: 17~273aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Borrelia burgdorferi Outer surface protein A (ospA) is a purified Recombinant Protein.

Accession Number

P0A3N6

Expression Region

17~273aa

Host

E. coli

Target

OspA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

OspA; Outer surface protein A

Species

Borreliella burgdorferi (Lyme disease spirochete) (Borrelia burgdorferi)

Protein Name

Recombinant Protein

AA Sequence

CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GROβ/CXCL2 (Growth Regulated Oncogene Beta) ELISA Kit
EM10637 96 Tests

Mouse GROβ/CXCL2 (Growth Regulated Oncogene Beta) ELISA Kit

Sign In for Pricing
View Details
MBTPS1 (Membrane-bound Transcription Factor Site-1 Protease, Endopeptidase S1P, Subtilisin/Kexin-isozyme 1, SKI-1, MBTPS1, KIAA0091, S1P, SKI1) (MaxLight 550)
MBS6457137-01 0.1 mL

MBTPS1 (Membrane-bound Transcription Factor Site-1 Protease, Endopeptidase S1P, Subtilisin/Kexin-isozyme 1, SKI-1, MBTPS1, KIAA0091, S1P, SKI1) (MaxLight 550)

Sign In for Pricing
View Details
MBTPS1 (Membrane-bound Transcription Factor Site-1 Protease, Endopeptidase S1P, Subtilisin/Kexin-isozyme 1, SKI-1, MBTPS1, KIAA0091, S1P, SKI1) (MaxLight 550)
MBS6457137-02 5x 0.1 mL

MBTPS1 (Membrane-bound Transcription Factor Site-1 Protease, Endopeptidase S1P, Subtilisin/Kexin-isozyme 1, SKI-1, MBTPS1, KIAA0091, S1P, SKI1) (MaxLight 550)

Sign In for Pricing
View Details
NEU2 Antibody
orb40998-01 50 μL

NEU2 Antibody

Sign In for Pricing
View Details
NEU2 Antibody
orb40998-02 100 µL

NEU2 Antibody

Sign In for Pricing
View Details
Fus ORF Vector (Mouse) (pORF)
ORF045137 1.0 µg DNA

Fus ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details