Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ab. Target Synonyms: 130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (b) . Accession Number: P0A370. Expression Region: 1022~1155aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial is a purified Recombinant Protein.

Accession Number

P0A370

Expression Region

1022~1155aa

Host

E. coli

Target

Cry1Ab

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (b)

Species

Bacillus thuringiensis subsp. kurstaki

Protein Name

Recombinant Protein

AA Sequence

HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPG Human shRNA Lentiviral Particle (Locus ID 6637)
TL316733V 500 µL Each

SNRPG Human shRNA Lentiviral Particle (Locus ID 6637)

Sign In for Pricing
View Details
Manganese (II) sulfate monohydrate discontinued. See M2200
283770 5 Kg

Manganese (II) sulfate monohydrate discontinued. See M2200

Sign In for Pricing
View Details
TRAF4AF1 (KNSTRN) (NM_033286) Human 3' UTR Clone
SC209013 10 µg

TRAF4AF1 (KNSTRN) (NM_033286) Human 3' UTR Clone

Sign In for Pricing
View Details
Anti-PTGER3 Rabbit pAb
GB113920 100 μL

Anti-PTGER3 Rabbit pAb

Sign In for Pricing
View Details
HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754) (MaxLight 750) discontinued
128065-ML750 100 µL

HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Transcription Factor 4 (TCF4) Antibody
abx149368 100 µg

Transcription Factor 4 (TCF4) Antibody

Sign In for Pricing
View Details