Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ab. Target Synonyms: 130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (b) . Accession Number: P0A370. Expression Region: 1022~1155aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial is a purified Recombinant Protein.

Accession Number

P0A370

Expression Region

1022~1155aa

Host

E. coli

Target

Cry1Ab

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (b)

Species

Bacillus thuringiensis subsp. kurstaki

Protein Name

Recombinant Protein

AA Sequence

HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque SNRPG Protein, His (Fc)-Avi-tagged
SNRPG-4199R 50 µg

Recombinant Rhesus Macaque SNRPG Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rat Heat Shock Protein 90kDa Alpha A1 ELISA Kit (HSP90aA1)
RK03728 96 Tests

Rat Heat Shock Protein 90kDa Alpha A1 ELISA Kit (HSP90aA1)

Sign In for Pricing
View Details
WDR1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
50298126 3x 1.0µg DNA

WDR1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
VAMP5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2604807 1.0 µg DNA

VAMP5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AMAC1L1 3'UTR GFP Stable Cell Line
TU050681 1.0 mL

AMAC1L1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MAGOH Antibody
MBS7046450-01 0.05 mL

MAGOH Antibody

Sign In for Pricing
View Details