Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus A serotype 89 Genome polyprotein

Recombinant Human rhinovirus A serotype 89 Genome polyprotein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89) . Target Name: Human rhinovirus A serotype 89 Genome polyprotein. Target Synonyms: Genome polyprotein; Cleaved into: P1; Capsid protein VP0; VP4-VP2; Capsid protein VP4; P1A; Virion protein 4; Capsid protein VP2. Accession Number: P07210. Expression Region: 575~866aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human rhinovirus A serotype 89 Genome polyprotein is a purified Recombinant Protein.

Accession Number

P07210

Expression Region

575~866aa

Host

E. coli

Target

Human rhinovirus A serotype 89 Genome polyprotein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Genome polyprotein; Cleaved into: P1; Capsid protein VP0; VP4-VP2; Capsid protein VP4; P1A; Virion protein 4; Capsid protein VP2; P1B; Virion protein 2; Capsid protein VP3; P1C; Virion protein 3; Capsid protein VP1; P1D; Virion protein 1; P2; Protease 2A; P2A; EC 3.4.22.29; Picornain 2A; Protein 2A; Protein 2B; P2B; Protein 2C; P2C; EC 3.6.1.15; P3; Protein 3AB; Protein 3A; P3A; Viral protein genome-linked; VPg; Protein 3B; P3B; Protein 3CD; EC 3.4.22.28; Protease 3C; EC 3.4.22.28; Picornain 3C; P3C; RNA-directed RNA polymerase; RdRp; EC 2.7.7.48; 3D polymerase; 3Dpol; Protein 3D; 3D

Species

Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

Protein Name

Recombinant Protein

AA Sequence

NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cyclin E Antibody, Rabbit Polyclonal
MBS8104306-01 0.1 mL

Anti-Cyclin E Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cyclin E Antibody, Rabbit Polyclonal
MBS8104306-02 5x 0.1 mL

Anti-Cyclin E Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rabbit PPIP5K2 Antibody
orb1523494-01 10 µL

Rabbit PPIP5K2 Antibody

Sign In for Pricing
View Details
Rabbit PPIP5K2 Antibody
orb1523494-02 100 µL

Rabbit PPIP5K2 Antibody

Sign In for Pricing
View Details
GMDS Rabbit Polyclonal Antibody (BF555)
orb2524684 100 µL

GMDS Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Mouse Monoclonal Latexin Antibody (02) [DyLight 755]
NBP3-06086IR 0.1 mL

Mouse Monoclonal Latexin Antibody (02) [DyLight 755]

Sign In for Pricing
View Details