Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Major urinary protein 6 (Mup6)

Recombinant Mouse Major urinary protein 6 (Mup6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Mup6. Target Synonyms: Alpha-2U-globulinGroup 1, BS6Allergen: Mus m 1. Accession Number: P02762. Expression Region: 19~180aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Major urinary protein 6 (Mup6) is a purified Recombinant Protein.

Accession Number

P02762

Expression Region

19~180aa

Host

E. coli

Target

Mup6

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Alpha-2U-globulinGroup 1, BS6Allergen: Mus m 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDRD6 Human qPCR Primer Pair (NM_001010870)
HP202054 200 Reactions

TDRD6 Human qPCR Primer Pair (NM_001010870)

Sign In for Pricing
View Details
Mouse Monoclonal CD3 epsilon Antibody (rC3e/6967) [Alexa Fluor 700]
NBP3-24081AF700 0.1 mL

Mouse Monoclonal CD3 epsilon Antibody (rC3e/6967) [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Clostridium kluyveri 1-deoxy-D-xylulose-5-phosphate synthase (dxs), partial
MBS1081109 Inquire

Recombinant Clostridium kluyveri 1-deoxy-D-xylulose-5-phosphate synthase (dxs), partial

Sign In for Pricing
View Details
Bovine Protein S100-A4, S100A4 ELISA KIT
JOT-EK0460Bo-01 96 Well

Bovine Protein S100-A4, S100A4 ELISA KIT

Sign In for Pricing
View Details
Bovine Protein S100-A4, S100A4 ELISA KIT
JOT-EK0460Bo-02 48 Well

Bovine Protein S100-A4, S100A4 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human MEF2A shRNA (UAS) - Lentiviral human MEF2A shRNA (UAS) (25)
GTR15104849 1 Vial

Lentiviral human MEF2A shRNA (UAS) - Lentiviral human MEF2A shRNA (UAS) (25)

Sign In for Pricing
View Details