Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Major urinary protein 6 (Mup6)

Recombinant Mouse Major urinary protein 6 (Mup6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Mup6. Target Synonyms: Alpha-2U-globulinGroup 1, BS6Allergen: Mus m 1. Accession Number: P02762. Expression Region: 19~180aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Major urinary protein 6 (Mup6) is a purified Recombinant Protein.

Accession Number

P02762

Expression Region

19~180aa

Host

E. coli

Target

Mup6

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Alpha-2U-globulinGroup 1, BS6Allergen: Mus m 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lrrtm4 shRNA (UAS) - Lentiviral mouse Lrrtm4 shRNA (UAS) (100)
GTR15233322 1 Vial

Lentiviral mouse Lrrtm4 shRNA (UAS) - Lentiviral mouse Lrrtm4 shRNA (UAS) (100)

Sign In for Pricing
View Details
DULLARD, ID (CTDNEP1, DULLARD, CTD nuclear envelope phosphatase 1, Serine/threonine-protein phosphatase dullard) (MaxLight 405) discontinued
034844-ML405 100 µL

DULLARD, ID (CTDNEP1, DULLARD, CTD nuclear envelope phosphatase 1, Serine/threonine-protein phosphatase dullard) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Benchmark Beadblaster 96 10mm Stainless Steel Grinding Balls 500g
HOM3222 500 g

Benchmark Beadblaster 96 10mm Stainless Steel Grinding Balls 500g

Sign In for Pricing
View Details
Lypla2-set siRNA/shRNA/RNAi Lentivector (Mouse)
27845094 4x 500 ng

Lypla2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Citral
163147 5 g

Citral

Sign In for Pricing
View Details
Plac9 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4072803 1.0 µg DNA

Plac9 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details