Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Endolysin (E)

Recombinant Enterobacteria phage T4 Endolysin (E) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4) . Target Name: E. Target Synonyms: Lysis proteinLysozymeMuramidase. Accession Number: P00720. Expression Region: 1~164aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterobacteria phage T4 Endolysin (E) is a purified Recombinant Protein.

Accession Number

P00720

Expression Region

1~164aa

Host

E. coli

Target

E

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Lysis proteinLysozymeMuramidase

Species

Enterobacteria phage T4 (Bacteriophage T4)

Protein Name

Recombinant Protein

AA Sequence

MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT3A / CBP Polyclonal Antibody, FITC Conjugated
bs-12395R-FITC 100 µL

KAT3A / CBP Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
TLL2 Protein Vector (Rat) (pPM-C-HA)
46767026 500 ng

TLL2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NUDC Antibody
E043082 100 µg -100 µL

NUDC Antibody

Sign In for Pricing
View Details
Human CCR1 (Chemokine C-C-Motif Receptor 1) Microsample ELISA Kit
ELK4621MS-01 48 Tests

Human CCR1 (Chemokine C-C-Motif Receptor 1) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CCR1 (Chemokine C-C-Motif Receptor 1) Microsample ELISA Kit
ELK4621MS-02 96 Tests

Human CCR1 (Chemokine C-C-Motif Receptor 1) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CCR1 (Chemokine C-C-Motif Receptor 1) Microsample ELISA Kit
ELK4621MS-03 5x 96 Tests

Human CCR1 (Chemokine C-C-Motif Receptor 1) Microsample ELISA Kit

Sign In for Pricing
View Details