Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Recombination protein RecR (recR)

Recombinant E. coli Recombination protein RecR (recR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: recR. Target Synonyms: recR; b0472; JW0461; Recombination protein RecR. Accession Number: P0A7H6. Expression Region: 1~201aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 38kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Recombination protein RecR (recR) is a purified Recombinant Protein.

Accession Number

P0A7H6

Expression Region

1~201aa

Host

E. coli

Target

RecR

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RecR; b0472; JW0461; Recombination protein RecR

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mcl 1 (Myeloid Cell Leukemia 1, Mcl-1, Bcl 2 Related Protein EAT/Mcl1, Bcl2 Related, EAT, Induced Myeloid Leukemia Cell Differentiation Protein, Mcl1/EAT, MCL1L, MCL1S, MGC104264, MGC1839, Myeloid Cell Leukemia Sequence 1, TM) (MaxLight 490) discontinued
M2749-ML490 100 µL

Mcl 1 (Myeloid Cell Leukemia 1, Mcl-1, Bcl 2 Related Protein EAT/Mcl1, Bcl2 Related, EAT, Induced Myeloid Leukemia Cell Differentiation Protein, Mcl1/EAT, MCL1L, MCL1S, MGC104264, MGC1839, Myeloid Cell Leukemia Sequence 1, TM) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal NCBP1 Antibody
NBP2-33897 0.1 mL

Rabbit Polyclonal NCBP1 Antibody

Sign In for Pricing
View Details
EMID2 Recombinant Protein (Human)
RP038746 100 µg

EMID2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Phospho-DDR1 (Tyr792) Polyclonal Antibody
MF-0084651-01 50 µL

Anti-Phospho-DDR1 (Tyr792) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-DDR1 (Tyr792) Polyclonal Antibody
MF-0084651-02 100 µL

Anti-Phospho-DDR1 (Tyr792) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ZCCHC24 shRNA (UAS) - Lentiviral human ZCCHC24 shRNA (UAS, iRFP) (100)
GTR15081555 1 Vial

Lentiviral human ZCCHC24 shRNA (UAS) - Lentiviral human ZCCHC24 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details