Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage 933W (Bacteriophage 933W) . Target Name: stxB2. Target Synonyms: Verocytotoxin 2 subunit B; Verotoxin 2 subunit B. Accession Number: P09386. Expression Region: 20~89aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) is a purified Recombinant Protein.

Accession Number

P09386

Expression Region

20~89aa

Host

E. coli

Target

StxB2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Verocytotoxin 2 subunit B; Verotoxin 2 subunit B

Species

Enterobacteria phage 933W (Bacteriophage 933W)

Protein Name

Recombinant Protein

AA Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H3 [p Thr3] Antibody (159)
NBP2-61546 100 µg

Rabbit Monoclonal Histone H3 [p Thr3] Antibody (159)

Request Quote
View Details
C5ARL Polyclonal Antibody
RA31345-01 50 µL

C5ARL Polyclonal Antibody

Request Quote
View Details
C5ARL Polyclonal Antibody
RA31345-02 100 µL

C5ARL Polyclonal Antibody

Request Quote
View Details
Rabbit anti-Sheep Interleukin-12 subunit beta polyclonal Antibody, Biotin conjugated
MBS1490351-01 0.05 mg

Rabbit anti-Sheep Interleukin-12 subunit beta polyclonal Antibody, Biotin conjugated

Request Quote
View Details
Rabbit anti-Sheep Interleukin-12 subunit beta polyclonal Antibody, Biotin conjugated
MBS1490351-02 0.1 mg

Rabbit anti-Sheep Interleukin-12 subunit beta polyclonal Antibody, Biotin conjugated

Request Quote
View Details
Rabbit anti-Sheep Interleukin-12 subunit beta polyclonal Antibody, Biotin conjugated
MBS1490351-03 5x 0.1 mg

Rabbit anti-Sheep Interleukin-12 subunit beta polyclonal Antibody, Biotin conjugated

Request Quote
View Details