Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Outer membrane porin C (ompC)

Recombinant E. coli Outer membrane porin C (ompC) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: ompC. Target Synonyms: Outer membrane protein 1BPorin OmpC. Accession Number: P06996. Expression Region: 22~367aa. Tag Info: Tag-Free. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Outer membrane porin C (ompC) is a purified Recombinant Protein.

Accession Number

P06996

Expression Region

22~367aa

Host

E. coli

Target

OmpC

Conjugation

Unconjugated

Tag

Tag-Free

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein 1BPorin OmpC

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kallikrein 6 (KLK6) ELISA Kit
RDR-KLK6-Mu-01 96 Tests

Mouse Kallikrein 6 (KLK6) ELISA Kit

Sign In for Pricing
View Details
Mouse Kallikrein 6 (KLK6) ELISA Kit
RDR-KLK6-Mu-02 48 Tests

Mouse Kallikrein 6 (KLK6) ELISA Kit

Sign In for Pricing
View Details
ZEB2 (Zinc Finger E-box-binding Homeobox 2, HRIHFB2411, KIAA0569, Smad-interacting Protein 1, SMADIP1, SIP1, SIP-1, Zinc Finger Homeobox Protein 1b, ZFHX1B, ZFX1B, HSPC082) (HRP)
MBS6155823-01 0.1 mL

ZEB2 (Zinc Finger E-box-binding Homeobox 2, HRIHFB2411, KIAA0569, Smad-interacting Protein 1, SMADIP1, SIP1, SIP-1, Zinc Finger Homeobox Protein 1b, ZFHX1B, ZFX1B, HSPC082) (HRP)

Sign In for Pricing
View Details
ZEB2 (Zinc Finger E-box-binding Homeobox 2, HRIHFB2411, KIAA0569, Smad-interacting Protein 1, SMADIP1, SIP1, SIP-1, Zinc Finger Homeobox Protein 1b, ZFHX1B, ZFX1B, HSPC082) (HRP)
MBS6155823-02 5x 0.1 mL

ZEB2 (Zinc Finger E-box-binding Homeobox 2, HRIHFB2411, KIAA0569, Smad-interacting Protein 1, SMADIP1, SIP1, SIP-1, Zinc Finger Homeobox Protein 1b, ZFHX1B, ZFX1B, HSPC082) (HRP)

Sign In for Pricing
View Details
Rabbit Anti-RAB2 antibody
SL6174R-01 50 µL

Rabbit Anti-RAB2 antibody

Sign In for Pricing
View Details
Rabbit Anti-RAB2 antibody
SL6174R-02 100 µL

Rabbit Anti-RAB2 antibody

Sign In for Pricing
View Details