Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Outer membrane porin C (ompC)

Recombinant E. coli Outer membrane porin C (ompC) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: ompC. Target Synonyms: Outer membrane protein 1BPorin OmpCmeoA, par. Accession Number: P06996. Expression Region: 22~367aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Outer membrane porin C (ompC) is a purified Recombinant Protein.

Accession Number

P06996

Expression Region

22~367aa

Host

E. coli

Target

OmpC

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein 1BPorin OmpCmeoA, par

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAG608 Polyclonal Antibody, Cy5 Conjugated
bs-0942R-Cy5 100 µL

PAG608 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae VC_1508 Protein (aa 1-160)
VAng-Cr3476-1mgEcoli 1 mg (E. coli)

Recombinant Vibrio Cholerae VC_1508 Protein (aa 1-160)

Sign In for Pricing
View Details
UBE3B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
49018062 1.0 µg DNA

UBE3B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Argonaute 4 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-12518R-PE-Cy5.5 100 µL

Argonaute 4 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
FLRT3 Protein Vector (Human) (pPM-C-HA)
PV016475 500 ng

FLRT3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MMP1 Rabbit Polyclonal Antibody
AF0231 50 µL

MMP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details