Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ac. Target Synonyms: 133 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (c) . Accession Number: P05068. Expression Region: 972~1178aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 50.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial is a purified Recombinant Protein.

Accession Number

P05068

Expression Region

972~1178aa

Host

E. coli

Target

Cry1Ac

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

133 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (c)

Species

Bacillus thuringiensis subsp. kurstaki

Protein Name

Recombinant Protein

AA Sequence

LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbx4 Rat siRNA Oligo Duplex (Locus ID 303399)
SR515377 1 Kit

Tbx4 Rat siRNA Oligo Duplex (Locus ID 303399)

Sign In for Pricing
View Details
RBP7, ID (RBP7, Retinoid-binding protein 7, Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV) (Azide free) (HRP)
MBS6340953-01 0.2 mL

RBP7, ID (RBP7, Retinoid-binding protein 7, Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV) (Azide free) (HRP)

Sign In for Pricing
View Details
RBP7, ID (RBP7, Retinoid-binding protein 7, Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV) (Azide free) (HRP)
MBS6340953-02 5x 0.2 mL

RBP7, ID (RBP7, Retinoid-binding protein 7, Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV) (Azide free) (HRP)

Sign In for Pricing
View Details
Ppp1r15a Mouse Gene Knockout Kit (CRISPR)
KN513736 1 Kit

Ppp1r15a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PC9-EGFR-Del19/T790M/C797S Overexpressing Cell Line
RG-861 5x 10^6

PC9-EGFR-Del19/T790M/C797S Overexpressing Cell Line

Sign In for Pricing
View Details
Rabbit anti-Treponema pallidum (strain Nichols) tpn39b Polyclonal Antibody
MBS7155110 Inquire

Rabbit anti-Treponema pallidum (strain Nichols) tpn39b Polyclonal Antibody

Sign In for Pricing
View Details