Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ac. Target Synonyms: 133 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (c) . Accession Number: P05068. Expression Region: 972~1178aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 50.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial is a purified Recombinant Protein.

Accession Number

P05068

Expression Region

972~1178aa

Host

E. coli

Target

Cry1Ac

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

133 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA (c)

Species

Bacillus thuringiensis subsp. kurstaki

Protein Name

Recombinant Protein

AA Sequence

LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cage1 shRNA (UAS) - Lentiviral mouse Cage1 shRNA (UAS, iRFP) plasmid
GTR15204808 1 Vial

Lentiviral mouse Cage1 shRNA (UAS) - Lentiviral mouse Cage1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CCDC12 Protein Vector (Human) (pPM-C-His)
PV007800 500 ng

CCDC12 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FGF14 ORF Vector (Human) (pORF)
ORF013032 1.0 µg DNA

FGF14 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MAVS discontinued
538777-01 30ul

MAVS discontinued

Sign In for Pricing
View Details
MAVS discontinued
538777-02 100 µL

MAVS discontinued

Sign In for Pricing
View Details
Rat Low Density Lipoprotein Receptor, Ldlr Elisa Kit
EKC39352 96 Tests

Rat Low Density Lipoprotein Receptor, Ldlr Elisa Kit

Sign In for Pricing
View Details