Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Androctonus australis Alpha-mammal toxin AaH2

Recombinant Androctonus australis Alpha-mammal toxin AaH2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Androctonus australis (Sahara scorpion) . Target Name: Androctonus australis Alpha-mammal toxin AaH2. Target Synonyms: AaH IIAaHIINeurotoxin 2. Accession Number: P01484. Expression Region: 20~83aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Androctonus australis Alpha-mammal toxin AaH2 is a purified Recombinant Protein.

Accession Number

P01484

Expression Region

20~83aa

Host

E. coli

Target

Androctonus australis Alpha-mammal toxin AaH2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AaH IIAaHIINeurotoxin 2

Species

Androctonus australis (Sahara scorpion)

Protein Name

Recombinant Protein

AA Sequence

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAV1 Polyclonal Antibody
bs-55192R 100 µL

SAV1 Polyclonal Antibody

Sign In for Pricing
View Details
RAG2 Mouse mAb
MBS8538614-01 0.1 mL

RAG2 Mouse mAb

Sign In for Pricing
View Details
RAG2 Mouse mAb
MBS8538614-02 0.1 mL (AF405L)

RAG2 Mouse mAb

Sign In for Pricing
View Details
RAG2 Mouse mAb
MBS8538614-03 0.1 mL (AF405S)

RAG2 Mouse mAb

Sign In for Pricing
View Details
RAG2 Mouse mAb
MBS8538614-04 0.1 mL (AF610)

RAG2 Mouse mAb

Sign In for Pricing
View Details
RAG2 Mouse mAb
MBS8538614-05 0.1 mL (AF635)

RAG2 Mouse mAb

Sign In for Pricing
View Details