Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Androctonus australis Alpha-mammal toxin AaH2

Recombinant Androctonus australis Alpha-mammal toxin AaH2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Androctonus australis (Sahara scorpion) . Target Name: Androctonus australis Alpha-mammal toxin AaH2. Target Synonyms: AaH IIAaHIINeurotoxin 2. Accession Number: P01484. Expression Region: 20~83aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Androctonus australis Alpha-mammal toxin AaH2 is a purified Recombinant Protein.

Accession Number

P01484

Expression Region

20~83aa

Host

E. coli

Target

Androctonus australis Alpha-mammal toxin AaH2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AaH IIAaHIINeurotoxin 2

Species

Androctonus australis (Sahara scorpion)

Protein Name

Recombinant Protein

AA Sequence

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3, acetylated (Lys9, Lys14) (HRP)
MBS6480681-01 0.1 mL

Histone H3, acetylated (Lys9, Lys14) (HRP)

Sign In for Pricing
View Details
Histone H3, acetylated (Lys9, Lys14) (HRP)
MBS6480681-02 5x 0.1 mL

Histone H3, acetylated (Lys9, Lys14) (HRP)

Sign In for Pricing
View Details
Hsa-miR-5007-3p miRNA Mimic
CMH1748-01 5 nmol

Hsa-miR-5007-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-5007-3p miRNA Mimic
CMH1748-02 10 nmol

Hsa-miR-5007-3p miRNA Mimic

Sign In for Pricing
View Details
SLC22A7 Antibody - C-terminal region
ARP42708_P050-25UL 25 µL

SLC22A7 Antibody - C-terminal region

Sign In for Pricing
View Details
FASTKD1 CRISPRa sgRNA lentivector (set of three targets)(Human)
20258121 3x 1.0µg DNA

FASTKD1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details