Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Adapter protein MecA (mecA)

Recombinant Staphylococcus aureus Adapter protein MecA (mecA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MW2) . Target Name: mecA. Target Synonyms: mecA; MW0880Adapter protein MecA. Accession Number: P60186. Expression Region: 1~239aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Adapter protein MecA (mecA) is a purified Recombinant Protein.

Accession Number

P60186

Expression Region

1~239aa

Host

E. coli

Target

MecA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MecA; MW0880Adapter protein MecA

Species

Staphylococcus aureus (strain MW2)

Protein Name

Recombinant Protein

AA Sequence

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus UPF0060 membrane protein SaurJH1_2408 (SaurJH1_2408)
orb2922392-01 20 µg

Recombinant Staphylococcus aureus UPF0060 membrane protein SaurJH1_2408 (SaurJH1_2408)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0060 membrane protein SaurJH1_2408 (SaurJH1_2408)
orb2922392-02 100 µg

Recombinant Staphylococcus aureus UPF0060 membrane protein SaurJH1_2408 (SaurJH1_2408)

Sign In for Pricing
View Details
HAND1 siRNA (Rat)
CRR1628-01 15 nmol

HAND1 siRNA (Rat)

Sign In for Pricing
View Details
HAND1 siRNA (Rat)
CRR1628-02 30 nmol

HAND1 siRNA (Rat)

Sign In for Pricing
View Details
Neurotensin (Human Proneurotensin, Large Neuromedin N, Neuromedin N Preproprotein, NMN-125, NN, NT, NT/N, NTRH, NTS, NTS1, Proneuromedin N mRNA, Tail Peptide) (MaxLight 750) discontinued
N2177-01-ML750 100 µL

Neurotensin (Human Proneurotensin, Large Neuromedin N, Neuromedin N Preproprotein, NMN-125, NN, NT, NT/N, NTRH, NTS, NTS1, Proneuromedin N mRNA, Tail Peptide) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-Human CD27 Antibody (5F24), PE
HB796227-01 1 Each

Anti-Human CD27 Antibody (5F24), PE

Sign In for Pricing
View Details