Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Adapter protein MecA (mecA)

Recombinant Staphylococcus aureus Adapter protein MecA (mecA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MW2) . Target Name: mecA. Target Synonyms: mecA; MW0880Adapter protein MecA. Accession Number: P60186. Expression Region: 1~239aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Adapter protein MecA (mecA) is a purified Recombinant Protein.

Accession Number

P60186

Expression Region

1~239aa

Host

E. coli

Target

MecA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MecA; MW0880Adapter protein MecA

Species

Staphylococcus aureus (strain MW2)

Protein Name

Recombinant Protein

AA Sequence

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LBR Antibody
ABD7356 100 µg

LBR Antibody

Sign In for Pricing
View Details
Recombinant Human ER lumen protein retaining receptor 3 (KDELR3), partial
MBS7055216 Inquire

Recombinant Human ER lumen protein retaining receptor 3 (KDELR3), partial

Sign In for Pricing
View Details
KRT23 Antibody
orb1560780-01 50 µL

KRT23 Antibody

Sign In for Pricing
View Details
KRT23 Antibody
orb1560780-02 100 µL

KRT23 Antibody

Sign In for Pricing
View Details
KRT23 Antibody
orb1560780-03 200 µL

KRT23 Antibody

Sign In for Pricing
View Details
PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, SK 1, ATPSK1, PAPSS) (MaxLight 650)
MBS6223648-01 0.1 mL

PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, SK 1, ATPSK1, PAPSS) (MaxLight 650)

Sign In for Pricing
View Details