Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1)

Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hypocrea jecorina (Trichoderma reesei) . Target Name: hfb1. Target Synonyms: Hydrophobin IHFBI. Accession Number: P52754. Expression Region: 23~97aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) is a purified Recombinant Protein.

Accession Number

P52754

Expression Region

23~97aa

Host

E. coli

Target

Hfb1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hydrophobin IHFBI

Species

Hypocrea jecorina (Trichoderma reesei)

Protein Name

Recombinant Protein

AA Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3GLB2 Antibody
8C18717-AAT 50 µg

SH3GLB2 Antibody

Sign In for Pricing
View Details
Cyclin B1 Antibody (CCNB1)
F41196-0.4ML 0.4 mL

Cyclin B1 Antibody (CCNB1)

Sign In for Pricing
View Details
B4GALT3 Protein Vector (Rat) (pPM-C-HA)
12954026 500 ng

B4GALT3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Anti Human Cd40 Monoclonal Antibody
CABT-46037MH 0.1 mg

Mouse Anti Human Cd40 Monoclonal Antibody

Sign In for Pricing
View Details
Dhrs2 (NM_027790) Mouse Tagged ORF Clone
MR212207 10 µg

Dhrs2 (NM_027790) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CENPM (C22orf18, ICEN39, PANE1, Centromere Protein M, Interphase Centromere Complex Protein 39, Proliferation-associated Nuclear Element Protein 1, MGC861, PANE1, BK250D10.2) (MaxLight 550)
MBS6373671-01 0.1 mL

CENPM (C22orf18, ICEN39, PANE1, Centromere Protein M, Interphase Centromere Complex Protein 39, Proliferation-associated Nuclear Element Protein 1, MGC861, PANE1, BK250D10.2) (MaxLight 550)

Sign In for Pricing
View Details