Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1)

Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: PNC1. Target Synonyms: Nicotinamide deamidase. Accession Number: P53184. Expression Region: 1~216aa. Tag Info: Tag-Free. Theoretical MW: 25kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1) is a purified Recombinant Protein.

Accession Number

P53184

Expression Region

1~216aa

Host

E. coli

Target

PNC1

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nicotinamide deamidase

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A*0201 P53 R175H Complex Tetramer, Human (HEK293, His-Avi)
HY-P77777-01 20 µg

HLA-A*0201 P53 R175H Complex Tetramer, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
HLA-A*0201 P53 R175H Complex Tetramer, Human (HEK293, His-Avi)
HY-P77777-02 50 µg

HLA-A*0201 P53 R175H Complex Tetramer, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
Rabbit Anti CCR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)
MBS8423089-01 0.12 mL

Rabbit Anti CCR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)

Sign In for Pricing
View Details
Rabbit Anti CCR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)
MBS8423089-02 0.2 mL

Rabbit Anti CCR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)

Sign In for Pricing
View Details
Rabbit Anti CCR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)
MBS8423089-03 5x 0.2 mL

Rabbit Anti CCR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)

Sign In for Pricing
View Details
BTNL2 3'UTR GFP Stable Cell Line
TU051976 1.0 mL

BTNL2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details