Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli dITP/XTP pyrophosphatase (rdgB)

Recombinant E. coli dITP/XTP pyrophosphatase (rdgB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: rdgB. Target Synonyms: Deoxyribonucleoside triphosphate pyrophosphohydrolase1Inosine triphosphate pyrophosphatase1ITPase1Non-canonical purine NTP pyrophosphataseUniRule annotation1. Accession Number: P52061. Expression Region: 1~197aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 41kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli dITP/XTP pyrophosphatase (rdgB) is a purified Recombinant Protein.

Accession Number

P52061

Expression Region

1~197aa

Host

E. coli

Target

RdgB

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Deoxyribonucleoside triphosphate pyrophosphohydrolase1Inosine triphosphate pyrophosphatase1ITPase1Non-canonical purine NTP pyrophosphataseUniRule annotation1Non-standard purine NTP pyrophosphataseUniRule annotation1Nucleoside-triphosphate diphosphataseUniRule annotation1Nucleoside-triphosphate pyrophosphataseUniRule annotation1NTPaseyggV

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKR Polyclonal Antibody
E20-73779 100 µg

PKR Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1330403-01 0.02 mg (E-Coli)

Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details
Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1330403-02 0.02 mg (Yeast)

Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details
Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1330403-03 0.1 mg (E-Coli)

Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details
Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1330403-04 0.1 mg (Yeast)

Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details
Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1330403-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus acidophilus Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details