Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2)

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa) . Target Name: LTP2. Target Synonyms: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101. Accession Number: P55958. Expression Region: 32~133aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein.

Accession Number

P55958

Expression Region

32~133aa

Host

E. coli

Target

LTP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101

Species

Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)

Protein Name

Recombinant Protein

AA Sequence

EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

K2C3 Conjugated Antibody
MBS9453602-01 0.1 mL (AF350)

K2C3 Conjugated Antibody

Sign In for Pricing
View Details
K2C3 Conjugated Antibody
MBS9453602-02 0.1 mL (AF405)

K2C3 Conjugated Antibody

Sign In for Pricing
View Details
K2C3 Conjugated Antibody
MBS9453602-03 0.1 mL (AF488)

K2C3 Conjugated Antibody

Sign In for Pricing
View Details
K2C3 Conjugated Antibody
MBS9453602-04 0.1 mL (AF555)

K2C3 Conjugated Antibody

Sign In for Pricing
View Details
K2C3 Conjugated Antibody
MBS9453602-05 0.1 mL (Biotin)

K2C3 Conjugated Antibody

Sign In for Pricing
View Details
Anti-CD47 Polyclonal Antibody
PHG17601 100 μg

Anti-CD47 Polyclonal Antibody

Sign In for Pricing
View Details