Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2)

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa) . Target Name: LTP2. Target Synonyms: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101. Accession Number: P55958. Expression Region: 32~133aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein.

Accession Number

P55958

Expression Region

32~133aa

Host

E. coli

Target

LTP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101

Species

Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)

Protein Name

Recombinant Protein

AA Sequence

EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPC sgRNA CRISPR Lentivector set (Human)
K2251201 3x 1.0 µg

SNRPC sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Eps8l3 shRNA (UAS) - Lentiviral mouse Eps8l3 shRNA (UAS) (100)
GTR15153738 1 Vial

Lentiviral mouse Eps8l3 shRNA (UAS) - Lentiviral mouse Eps8l3 shRNA (UAS) (100)

Sign In for Pricing
View Details
Tcfap2d AAV siRNA Pooled Vector
68122164 1.0 µg

Tcfap2d AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TPRKB Protein Vector (Mouse) (pPM-C-HA)
PV241028 500 ng

TPRKB Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
C130023O10Rik Mouse shRNA Lentiviral Particle (Locus ID 320230)
TL514556V 500 µL Each

C130023O10Rik Mouse shRNA Lentiviral Particle (Locus ID 320230)

Sign In for Pricing
View Details
FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (MaxLight 405)
MBS6190150-01 0.1 mL

FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (MaxLight 405)

Sign In for Pricing
View Details