Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2)

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa) . Target Name: LTP2. Target Synonyms: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101. Accession Number: P55958. Expression Region: 32~133aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein.

Accession Number

P55958

Expression Region

32~133aa

Host

E. coli

Target

LTP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101

Species

Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)

Protein Name

Recombinant Protein

AA Sequence

EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNase III Drosha Peptide
DF8601-BP 1 mg

RNase III Drosha Peptide

Sign In for Pricing
View Details
Human PIEZO1 Knockout A549 cell line
GTR15410417 1 Vial

Human PIEZO1 Knockout A549 cell line

Sign In for Pricing
View Details
ZNF345, NT (Zinc finger protein 345,ZNF345,) (AP)
MBS6366305-01 0.2 mL

ZNF345, NT (Zinc finger protein 345,ZNF345,) (AP)

Sign In for Pricing
View Details
ZNF345, NT (Zinc finger protein 345,ZNF345,) (AP)
MBS6366305-02 5x 0.2 mL

ZNF345, NT (Zinc finger protein 345,ZNF345,) (AP)

Sign In for Pricing
View Details
K Cadherin (CDH6) Rabbit Monoclonal Antibody
TA423952 100 µL

K Cadherin (CDH6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TEK, CT (Angiopoietin-1 Receptor, Tyrosine-protein Kinase Receptor TIE-2, Tyrosine-protein Kinase Receptor TEK, Tunica Interna Endothelial Cell Kinase, p140 TEK, CD202b, TIE2) (FITC) discontinued
T5498-71A-FITC 200 µL

TEK, CT (Angiopoietin-1 Receptor, Tyrosine-protein Kinase Receptor TIE-2, Tyrosine-protein Kinase Receptor TEK, Tunica Interna Endothelial Cell Kinase, p140 TEK, CD202b, TIE2) (FITC) discontinued

Sign In for Pricing
View Details