Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 52 Protein E7 (E7)

Recombinant Human papillomavirus type 52 Protein E7 (E7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 52. Target Name: E7. Target Synonyms: E7Protein E7. Accession Number: P36831. Expression Region: 1~99aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human papillomavirus type 52 Protein E7 (E7) is a purified Recombinant Protein.

Accession Number

P36831

Expression Region

1~99aa

Host

E. coli

Target

E7

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

E7Protein E7

Species

Human papillomavirus type 52

Protein Name

Recombinant Protein

AA Sequence

MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galnt7 3'UTR GFP Stable Cell Line
TU254933 1.0 mL

Galnt7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human ENGASE qPCR Primer Pair
QH50297S 200 Tests

Human ENGASE qPCR Primer Pair

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 IgM ELISAKit
MBS398092-01 96 Well

SARS-CoV-2 Spike S1 IgM ELISAKit

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 IgM ELISAKit
MBS398092-02 5x 96 Well

SARS-CoV-2 Spike S1 IgM ELISAKit

Sign In for Pricing
View Details
ANGPTL2 Recombinant Protein
OPCD01317-50UG 50 µg

ANGPTL2 Recombinant Protein

Sign In for Pricing
View Details
Ferritin Heavy Chain Antibody
orb622394-01 50 μL

Ferritin Heavy Chain Antibody

Sign In for Pricing
View Details