Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-2 (PRDX2)

Recombinant Human Peroxiredoxin-2 (PRDX2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRDX2. Target Synonyms: Natural killer cell-enhancing factor B. Accession Number: P32119. Expression Region: 2~198aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Peroxiredoxin-2 (PRDX2) is a purified Recombinant Protein.

Accession Number

P32119

Expression Region

2~198aa

Host

E. coli

Target

PRDX2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Natural killer cell-enhancing factor B

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Podoplanin Rabbit monoclonal antibody
E43S40463 100 µL

Podoplanin Rabbit monoclonal antibody

Sign In for Pricing
View Details
FADD, ID (FADD, MORT1, Protein FADD, Mediator of receptor induced toxicity, FAS-associated death domain protein, FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein) (PE) discontinued
035335-PE 200 µL

FADD, ID (FADD, MORT1, Protein FADD, Mediator of receptor induced toxicity, FAS-associated death domain protein, FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua L-rhamnose-proton symporter (rhaT), partial
MBS1148567-01 1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua L-rhamnose-proton symporter (rhaT), partial

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua L-rhamnose-proton symporter (rhaT), partial
MBS1148567-02 1 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua L-rhamnose-proton symporter (rhaT), partial

Sign In for Pricing
View Details
SSX3 Antibody - middle region : FITC (ARP51078_P050-FITC)
ARP51078_P050-FITC 100 µL

SSX3 Antibody - middle region : FITC (ARP51078_P050-FITC)

Sign In for Pricing
View Details
RGD1559682 3'UTR GFP Stable Cell Line
TU268063 1.0 mL

RGD1559682 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details