Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum C phage Main hemagglutinin component type C (HA-33)

Recombinant Clostridium botulinum C phage Main hemagglutinin component type C (HA-33) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum. Target Name: HA-33. Target Synonyms: HA 33 kDa subunitHA1. Accession Number: P0DPR0. Expression Region: 2~286aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Clostridium botulinum C phage Main hemagglutinin component type C (HA-33) is a purified Recombinant Protein.

Accession Number

P0DPR0

Expression Region

2~286aa

Host

E. coli

Target

HA-33

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HA 33 kDa subunitHA1

Species

Clostridium botulinum

Protein Name

Recombinant Protein

AA Sequence

SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RPL15P18 AAV siRNA Pooled Vector
40858161 1.0 µg

RPL15P18 AAV siRNA Pooled Vector

Ask
View Details
SLPI (ALK 1, ALK1, ALP, AntileukoProtease, AntileukoProteinase 1, AntileukoProteinase, AntileukoProteinase1, BLPI, Human seminal Protease Inhibitor, HUSI 1, HUSI, HUSI I, HUSI-1, MPI, Mucus Proteinase Inhibitor, Protease Inhibitor WAP4, Secretory leukocyte peptidase Inhibitor, Secretory leukocyte Protease Inhibitor, Seminal Proteinase Inhibitor, SLPI, SLPI_HUMAN, WAP four disulfide Core Domain Protein 4, WAP four-disulfide Core Domain Protein 4, WAP4, WFDC4) discontinued
225882-01 50 µL

SLPI (ALK 1, ALK1, ALP, AntileukoProtease, AntileukoProteinase 1, AntileukoProteinase, AntileukoProteinase1, BLPI, Human seminal Protease Inhibitor, HUSI 1, HUSI, HUSI I, HUSI-1, MPI, Mucus Proteinase Inhibitor, Protease Inhibitor WAP4, Secretory leukocyte peptidase Inhibitor, Secretory leukocyte Protease Inhibitor, Seminal Proteinase Inhibitor, SLPI, SLPI_HUMAN, WAP four disulfide Core Domain Protein 4, WAP four-disulfide Core Domain Protein 4, WAP4, WFDC4) discontinued

Ask
View Details
SLPI (ALK 1, ALK1, ALP, AntileukoProtease, AntileukoProteinase 1, AntileukoProteinase, AntileukoProteinase1, BLPI, Human seminal Protease Inhibitor, HUSI 1, HUSI, HUSI I, HUSI-1, MPI, Mucus Proteinase Inhibitor, Protease Inhibitor WAP4, Secretory leukocyte peptidase Inhibitor, Secretory leukocyte Protease Inhibitor, Seminal Proteinase Inhibitor, SLPI, SLPI_HUMAN, WAP four disulfide Core Domain Protein 4, WAP four-disulfide Core Domain Protein 4, WAP4, WFDC4) discontinued
225882-02 100 µL

SLPI (ALK 1, ALK1, ALP, AntileukoProtease, AntileukoProteinase 1, AntileukoProteinase, AntileukoProteinase1, BLPI, Human seminal Protease Inhibitor, HUSI 1, HUSI, HUSI I, HUSI-1, MPI, Mucus Proteinase Inhibitor, Protease Inhibitor WAP4, Secretory leukocyte peptidase Inhibitor, Secretory leukocyte Protease Inhibitor, Seminal Proteinase Inhibitor, SLPI, SLPI_HUMAN, WAP four disulfide Core Domain Protein 4, WAP four-disulfide Core Domain Protein 4, WAP4, WFDC4) discontinued

Ask
View Details
MIR383 Human MicroRNA Expression Plasmid (MI0000791)
SC400383 10 µg

MIR383 Human MicroRNA Expression Plasmid (MI0000791)

Ask
View Details
Porcine Gastrokine 1 GKN1 ELISA Kit
BG-POR11099 1 Each

Porcine Gastrokine 1 GKN1 ELISA Kit

Ask
View Details
MINA Blocking Peptide
MBS9620407-01 1 mg

MINA Blocking Peptide

Ask
View Details