Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Actinoplanes utahensis. Target Name: aac. Target Synonyms: Aculeacin-A acylase small subunitAculeacin-A acylase large subunit. Accession Number: P29958. Expression Region: 35~214aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein.

Accession Number

P29958

Expression Region

35~214aa

Host

E. coli

Target

Aac

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aculeacin-A acylase small subunitAculeacin-A acylase large subunit

Species

Actinoplanes utahensis

Protein Name

Recombinant Protein

AA Sequence

GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc finger protein 790 Recombinant Protein Antigen
NBP2-31625PEP 0.1 mL

Zinc finger protein 790 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bovine Cathepsin D (CTSD) ELISA Kit
EKU03028 96 Tests

Bovine Cathepsin D (CTSD) ELISA Kit

Sign In for Pricing
View Details
Histone H4 (acetyl K5) Rabbit Monoclonal Antibody [KD Validation]
E51K2111 40 µL

Histone H4 (acetyl K5) Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
TFDP1 Rabbit Polyclonal Antibody
E28PT4611 100 µL

TFDP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AIBZIP (Androgen Induced Basic Leucine Zipper, ATCE1, cAMP Responsive Element Binding Protein 3 Like 4, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, Attaching to CRE-like 1, Cyclic AMP-responsive Element-binding Protein 4, cAMP-responsive Element-binding Protein 4, Transcript Induced in Spermiogenesis Protein 40, hJAL, CREB3, CREB3L4, CREB4, JAL, TISP40) (MaxLight 650)
A0857-25A-ML650 100 µL

AIBZIP (Androgen Induced Basic Leucine Zipper, ATCE1, cAMP Responsive Element Binding Protein 3 Like 4, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, Attaching to CRE-like 1, Cyclic AMP-responsive Element-binding Protein 4, cAMP-responsive Element-binding Protein 4, Transcript Induced in Spermiogenesis Protein 40, hJAL, CREB3, CREB3L4, CREB4, JAL, TISP40) (MaxLight 650)

Sign In for Pricing
View Details
NKD2 (Protein Naked Cuticle Homolog 2, Naked-2, hNkd2) (MaxLight 490)
MBS6387068-01 0.1 mL

NKD2 (Protein Naked Cuticle Homolog 2, Naked-2, hNkd2) (MaxLight 490)

Sign In for Pricing
View Details