Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Actinoplanes utahensis. Target Name: aac. Target Synonyms: Aculeacin-A acylase small subunitAculeacin-A acylase large subunit. Accession Number: P29958. Expression Region: 35~214aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein.

Accession Number

P29958

Expression Region

35~214aa

Host

E. coli

Target

Aac

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aculeacin-A acylase small subunitAculeacin-A acylase large subunit

Species

Actinoplanes utahensis

Protein Name

Recombinant Protein

AA Sequence

GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT 4 (Signal Transducer and Activator of Transcription 4) (MaxLight 490)
MBS6501018-01 0.1 mL

STAT 4 (Signal Transducer and Activator of Transcription 4) (MaxLight 490)

Sign In for Pricing
View Details
STAT 4 (Signal Transducer and Activator of Transcription 4) (MaxLight 490)
MBS6501018-02 5x 0.1 mL

STAT 4 (Signal Transducer and Activator of Transcription 4) (MaxLight 490)

Sign In for Pricing
View Details
PLGA(viscosity0.26- 0.54dlg)
S01YF-0823-KX673 Each

PLGA(viscosity0.26- 0.54dlg)

Sign In for Pricing
View Details
SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)
MBS6498582-01 0.1 mL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)

Sign In for Pricing
View Details
SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)
MBS6498582-02 5x 0.1 mL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (APC)

Sign In for Pricing
View Details
Rabbit Anti-Human HLA-DMB pAb
PA16525-01 50 μL

Rabbit Anti-Human HLA-DMB pAb

Sign In for Pricing
View Details