Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Actinoplanes utahensis. Target Name: aac. Target Synonyms: Aculeacin-A acylase small subunitAculeacin-A acylase large subunit. Accession Number: P29958. Expression Region: 35~214aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein.

Accession Number

P29958

Expression Region

35~214aa

Host

E. coli

Target

Aac

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aculeacin-A acylase small subunitAculeacin-A acylase large subunit

Species

Actinoplanes utahensis

Protein Name

Recombinant Protein

AA Sequence

GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1306 Rat siRNA Oligo Duplex (Locus ID 300607)
SR507842 1 Kit

Olr1306 Rat siRNA Oligo Duplex (Locus ID 300607)

Sign In for Pricing
View Details
Runx3 sgRNA CRISPR Lentivector set (Rat)
K7121201 3x 1.0 µg

Runx3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human HPS6 sgRNA gene knockout kit - Lentiviral human HPS6 sgRNA gene knockout kit (plasmid)
GTR15365390 1 Vial

Lentiviral human HPS6 sgRNA gene knockout kit - Lentiviral human HPS6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
NAT8L Human qPCR Primer Pair (NM_178557)
HP218880 200 Reactions

NAT8L Human qPCR Primer Pair (NM_178557)

Sign In for Pricing
View Details
Rat Luteinizing Hormone ELISA Kit (Chemiluminescence)
NBP2-68054 1 Kit

Rat Luteinizing Hormone ELISA Kit (Chemiluminescence)

Sign In for Pricing
View Details
NLRP4, NT (NLRP4, NALP4, PAN2, PYPAF4, RNH2, NACHT, LRR and PYD domains-containing protein 4, Cancer/testis antigen 58, PAAD and NACHT-containing protein 2, PYRIN and NACHT-containing protein 2, PYRIN-containing APAF1-like protein 4, Ribonuclease inhibitor 2) (MaxLight 650) discontinued
039020-ML650 100 µL

NLRP4, NT (NLRP4, NALP4, PAN2, PYPAF4, RNH2, NACHT, LRR and PYD domains-containing protein 4, Cancer/testis antigen 58, PAAD and NACHT-containing protein 2, PYRIN and NACHT-containing protein 2, PYRIN-containing APAF1-like protein 4, Ribonuclease inhibitor 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details