Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Actinoplanes utahensis. Target Name: aac. Target Synonyms: Aculeacin-A acylase small subunitAculeacin-A acylase large subunit. Accession Number: P29958. Expression Region: 35~214aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial is a purified Recombinant Protein.

Accession Number

P29958

Expression Region

35~214aa

Host

E. coli

Target

Aac

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aculeacin-A acylase small subunitAculeacin-A acylase large subunit

Species

Actinoplanes utahensis

Protein Name

Recombinant Protein

AA Sequence

GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFL4 shRNA (h) Lentiviral Particles
sc-97270-V 200 µL

EGFL4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Human Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS160479-01 48 Well

Human Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Human Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS160479-02 96 Well

Human Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Human Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS160479-03 5x 96 Well

Human Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Human Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS160479-04 10x 96 Well

Human Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Kisspeptin Receptor (KISS1R) Monoclonal Antibody
CAU32734-01 100 µL

Kisspeptin Receptor (KISS1R) Monoclonal Antibody

Sign In for Pricing
View Details