Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabies virus Matrix protein (M)

Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabies virus (strain CVS-11) (RABV) . Target Name: M. Target Synonyms: Phosphoprotein M2. Accession Number: P25223. Expression Region: 1~202aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein.

Accession Number

P25223

Expression Region

1~202aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Phosphoprotein M2

Species

Rabies virus (strain CVS-11) (RABV)

Protein Name

Recombinant Protein

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SFTA3 (NM_001101341) Human Untagged Clone
SC317012 10 µg

SFTA3 (NM_001101341) Human Untagged Clone

Ask
View Details
ACSL6, ID (Long-chain-fatty-acid-CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, FACL6, ACS2, FACL6, KIAA0837, LACS5) (MaxLight 405)
MBS6460942-01 0.1 mL

ACSL6, ID (Long-chain-fatty-acid-CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, FACL6, ACS2, FACL6, KIAA0837, LACS5) (MaxLight 405)

Ask
View Details
ACSL6, ID (Long-chain-fatty-acid-CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, FACL6, ACS2, FACL6, KIAA0837, LACS5) (MaxLight 405)
MBS6460942-02 5x 0.1 mL

ACSL6, ID (Long-chain-fatty-acid-CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, FACL6, ACS2, FACL6, KIAA0837, LACS5) (MaxLight 405)

Ask
View Details
Lamin A/C (70kD Lamin, Cardiomyopathy Dilated 1A (Autosomal Dominant), CDCD1, CDDC, Charcot Marie Tooth Disease Axonal Type 2B1, CMD1A, CMT2B1, EMD2, FPL, FPLD, HGPS, IDC, Lamin A/C, Lamin A/C Isoform 1Precursor, Lamin A/C Isoform 2, Lamin A/C Isoform 3, LDP1, LFP, LGMD1B, Limb girdle muscular dystrophy 1B (Autosomal Dominant), LMN 1, LMN A, LMN C, LMN1, LMNA, LMNC, NY REN 32 antigen, PRO1, Progeria 1 (Hutchinson Gilford Type), Renal carcinoma antigen NY REN 32, Renalcarcinoma antigen NYREN32)
254135 2 mL

Lamin A/C (70kD Lamin, Cardiomyopathy Dilated 1A (Autosomal Dominant), CDCD1, CDDC, Charcot Marie Tooth Disease Axonal Type 2B1, CMD1A, CMT2B1, EMD2, FPL, FPLD, HGPS, IDC, Lamin A/C, Lamin A/C Isoform 1Precursor, Lamin A/C Isoform 2, Lamin A/C Isoform 3, LDP1, LFP, LGMD1B, Limb girdle muscular dystrophy 1B (Autosomal Dominant), LMN 1, LMN A, LMN C, LMN1, LMNA, LMNC, NY REN 32 antigen, PRO1, Progeria 1 (Hutchinson Gilford Type), Renal carcinoma antigen NY REN 32, Renalcarcinoma antigen NYREN32)

Ask
View Details
Rat Atp8b1 Pre-designed siRNA Set B
SI201187B 1 Each

Rat Atp8b1 Pre-designed siRNA Set B

Ask
View Details
MFSD2 (BC011587) Human Untagged Clone
SC106440 10 µg

MFSD2 (BC011587) Human Untagged Clone

Ask
View Details