Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF)

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: lukF. Target Synonyms: Gamma-hemolysin, H-gamma-I subunit. Accession Number: P31715. Expression Region: 26~323aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 54kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF) is a purified Recombinant Protein.

Accession Number

P31715

Expression Region

26~323aa

Host

E. coli

Target

LukF

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Gamma-hemolysin, H-gamma-I subunit

Species

Staphylococcus aureus

Protein Name

Recombinant Protein

AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-African malaria mosquito CTL4 Antibody-FITC Conjugate
DZ41077-FITC 200 µL/Vial

Anti-African malaria mosquito CTL4 Antibody-FITC Conjugate

Sign In for Pricing
View Details
OXLD1, Recombinant, Human, aa46-147, His-Tag (Oxidoreductase-Like Domain-Containing Protein 1)
218417-01 20 µg

OXLD1, Recombinant, Human, aa46-147, His-Tag (Oxidoreductase-Like Domain-Containing Protein 1)

Sign In for Pricing
View Details
OXLD1, Recombinant, Human, aa46-147, His-Tag (Oxidoreductase-Like Domain-Containing Protein 1)
218417-02 100 µg

OXLD1, Recombinant, Human, aa46-147, His-Tag (Oxidoreductase-Like Domain-Containing Protein 1)

Sign In for Pricing
View Details
Recombinant Human Phospholipase C Gamma 1 (PLCg1)
RPU43294-01 50 µg

Recombinant Human Phospholipase C Gamma 1 (PLCg1)

Sign In for Pricing
View Details
Recombinant Human Phospholipase C Gamma 1 (PLCg1)
RPU43294-02 100 µg

Recombinant Human Phospholipase C Gamma 1 (PLCg1)

Sign In for Pricing
View Details
Recombinant Human Phospholipase C Gamma 1 (PLCg1)
RPU43294-03 1 mg

Recombinant Human Phospholipase C Gamma 1 (PLCg1)

Sign In for Pricing
View Details