Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF)

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: lukF. Target Synonyms: Gamma-hemolysin, H-gamma-I subunit. Accession Number: P31715. Expression Region: 26~323aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 54kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF) is a purified Recombinant Protein.

Accession Number

P31715

Expression Region

26~323aa

Host

E. coli

Target

LukF

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Gamma-hemolysin, H-gamma-I subunit

Species

Staphylococcus aureus

Protein Name

Recombinant Protein

AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBX2 Protein Vector (Rat) (pPM-C-HA)
PV292568 500 ng

PBX2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Phd Finger Protein 6 (PHF6) Antibody
abx114422 100 µL

Phd Finger Protein 6 (PHF6) Antibody

Sign In for Pricing
View Details
RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (AP)
MBS6130272-01 0.1 mL

RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (AP)

Sign In for Pricing
View Details
RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (AP)
MBS6130272-02 5x 0.1 mL

RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (AP)

Sign In for Pricing
View Details
Gm13011 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21773064 1.0 µg DNA

Gm13011 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TCERG1L Antibody
orb1276345 100 µL

TCERG1L Antibody

Sign In for Pricing
View Details