Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Major outer membrane porin, serovar A (ompA)

Recombinant Chlamydia trachomatis Major outer membrane porin, serovar A (ompA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chlamydia trachomatis. Target Name: ompA. Target Synonyms: ompA; omp1A; Major outer membrane porin; serovar A; MOMP. Accession Number: P23732. Expression Region: 23~396aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Chlamydia trachomatis Major outer membrane porin, serovar A (ompA) is a purified Recombinant Protein.

Accession Number

P23732

Expression Region

23~396aa

Host

E. coli

Target

OmpA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

56.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

OmpA; omp1A; Major outer membrane porin; serovar A; MOMP

Species

Chlamydia trachomatis

Protein Name

Recombinant Protein

AA Sequence

LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAAPTTRDVAGLEKDPVVNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQSSGFDTANIVPNTALNQAVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAKPVLDTTTLNPTIAGKGTVVSSAENELADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details