Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ambrosia artemisiifolia Pectate lyase 1

Recombinant Ambrosia artemisiifolia Pectate lyase 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Ambrosia artemisiifolia (Short ragweed) . Target Name: Ambrosia artemisiifolia Pectate lyase 1. Target Synonyms: Antigen Amb a IAntigen EAgE. Accession Number: P27760. Expression Region: 26~398aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Ambrosia artemisiifolia Pectate lyase 1 is a purified Recombinant Protein.

Accession Number

P27760

Expression Region

26~398aa

Host

E. coli

Target

Ambrosia artemisiifolia Pectate lyase 1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Allergen

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Antigen Amb a IAntigen EAgE

Species

Ambrosia artemisiifolia (Short ragweed)

Protein Name

Recombinant Protein

AA Sequence

AEDVEEFLPSANETRRSLKACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAGLTLMNVKNIIIHNINIHDIKVCPGGMIKSNDGPPILRQQSDGDAINVAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMSWNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF1B (NM_005875) Human Over-expression Lysate
LH07931V 100 µg

EIF1B (NM_005875) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9320075-01 48 Well

Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9320075-02 96 Well

Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9320075-03 5x 96 Well

Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9320075-04 10x 96 Well

Human Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
2310043J07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3668608 1.0 µg DNA

2310043J07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details