Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Klk1b22. Target Synonyms: Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP AGlandular kallikrein K22; mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22. Accession Number: P15948. Expression Region: 25~259aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is a purified Recombinant Protein.

Accession Number

P15948

Expression Region

25~259aa

Host

E. coli

Target

Klk1b22

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP AGlandular kallikrein K22; mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GREB1 Protein Vector (Human) (pPM-C-His)
PV081644 500 ng

GREB1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rap1gap2 Mouse shRNA Plasmid (Locus ID 380711)
TL508562 1 Kit

Rap1gap2 Mouse shRNA Plasmid (Locus ID 380711)

Sign In for Pricing
View Details
Ell3 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6151702 1.0 µg DNA

Ell3 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-PGD Antibody, Affinity Purified
A305-404A-T 10 µg

Rabbit anti-PGD Antibody, Affinity Purified

Sign In for Pricing
View Details
DOCK2 (12V7) Mouse Monoclonal antibody
E28PE2416 100 µL

DOCK2 (12V7) Mouse Monoclonal antibody

Sign In for Pricing
View Details
p57 Kip2 (CDKN1C) (NM_000076) Human Tagged Lenti ORF Clone
RC209840L1 10 µg

p57 Kip2 (CDKN1C) (NM_000076) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details