Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Klk1b22. Target Synonyms: Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP AGlandular kallikrein K22; mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22. Accession Number: P15948. Expression Region: 25~259aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is a purified Recombinant Protein.

Accession Number

P15948

Expression Region

25~259aa

Host

E. coli

Target

Klk1b22

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP AGlandular kallikrein K22; mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

0610009D07Rik ORF Vector (Mouse) (pORF)
ORF036535 1.0 µg DNA

0610009D07Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
BUD31 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV674219 1.0 µg DNA

BUD31 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human NR2C1 (NM_003297) AAV Particle
RC218582A1V 250 µL

Human NR2C1 (NM_003297) AAV Particle

Sign In for Pricing
View Details
LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (H
MBS6384195-01 0.1 mL

LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (H

Sign In for Pricing
View Details
LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (H
MBS6384195-02 5x 0.1 mL

LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (H

Sign In for Pricing
View Details
ADAM21 (Disintegrin and Metalloproteinase Domain-Containing Protein 21, ADAM 21, 3424-, ADAM21) (FITC)
MBS6453976-01 0.1 mL

ADAM21 (Disintegrin and Metalloproteinase Domain-Containing Protein 21, ADAM 21, 3424-, ADAM21) (FITC)

Sign In for Pricing
View Details