Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Klk1b22. Target Synonyms: Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP AGlandular kallikrein K22; mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22. Accession Number: P15948. Expression Region: 25~259aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is a purified Recombinant Protein.

Accession Number

P15948

Expression Region

25~259aa

Host

E. coli

Target

Klk1b22

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP AGlandular kallikrein K22; mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp709l1 Rat shRNA Plasmid (Locus ID 690419)
TL709091 1 Kit

Zfp709l1 Rat shRNA Plasmid (Locus ID 690419)

Sign In for Pricing
View Details
TRIM69 sgRNA CRISPR Lentivector set (Human)
K2469101 3x 1.0 µg

TRIM69 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ENO3 Polyclonal Antibody
ANT-12043-100ug 100 µg

ENO3 Polyclonal Antibody

Sign In for Pricing
View Details
NARG1 (NAA15) Human siRNA Oligo Duplex (Locus ID 80155)
SR312817 1 Kit

NARG1 (NAA15) Human siRNA Oligo Duplex (Locus ID 80155)

Sign In for Pricing
View Details
CTNNB1 Antibody (C-term)
AM8631b 200 µL

CTNNB1 Antibody (C-term)

Sign In for Pricing
View Details
X11β (E-4)
sc-376510 200 µg/mL

X11β (E-4)

Sign In for Pricing
View Details