Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus 14 kDa fusion protein (A27L)

Recombinant Vaccinia virus 14 kDa fusion protein (A27L) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Copenhagen) (VACV) . Target Name: A27L. Target Synonyms: A27L14 kDa fusion protein. Accession Number: P20535. Expression Region: 1~110aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus 14 kDa fusion protein (A27L) is a purified Recombinant Protein.

Accession Number

P20535

Expression Region

1~110aa

Host

E. coli

Target

A27L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

A27L14 kDa fusion protein

Species

Vaccinia virus (strain Copenhagen) (VACV)

Protein Name

Recombinant Protein

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal VDR/NR1I1/Vitamin D Receptor Antibody [DyLight 350]
NBP2-98840UV 0.1 mL

Rabbit Polyclonal VDR/NR1I1/Vitamin D Receptor Antibody [DyLight 350]

Sign In for Pricing
View Details
Stxbp4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4512906 1.0 µg DNA

Stxbp4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Clostridium Cellulolyticum Ccel_2565 Protein (aa 1-193)
VAng-Lsx8896-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Cellulolyticum Ccel_2565 Protein (aa 1-193)

Sign In for Pricing
View Details
Mouse Srrm4 Pre-designed siRNA Set A
SI113841A 1 Each

Mouse Srrm4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
APOBEC3B siRNA (Human)
CRH6376-01 15 nmol

APOBEC3B siRNA (Human)

Sign In for Pricing
View Details
APOBEC3B siRNA (Human)
CRH6376-02 30 nmol

APOBEC3B siRNA (Human)

Sign In for Pricing
View Details