Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) . Target Name: NP. Target Synonyms: Nucleocapsid protein; Protein N. Accession Number: P18272. Expression Region: 488~739aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.1 kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is a purified Recombinant Protein.

Accession Number

P18272

Expression Region

488~739aa

Host

E. coli

Target

NP

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.1 kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nucleocapsid protein; Protein N

Species

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Protein Name

Recombinant Protein

AA Sequence

LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBR2 Polyclonal Antibody, Biotin Conjugated
A66033-100 100 µL

UBR2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Anti-NUT Rabbit pAb
GB112941-100 100 μL

Anti-NUT Rabbit pAb

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 1 (CCR1) ELISA Kit
BSKH61913-01 48 Tests

Human Chemokine C-C-Motif Receptor 1 (CCR1) ELISA Kit

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 1 (CCR1) ELISA Kit
BSKH61913-02 96 Tests

Human Chemokine C-C-Motif Receptor 1 (CCR1) ELISA Kit

Sign In for Pricing
View Details
Pitx1 (G-4) HRP
sc-271435 HRP 200 µg/mL

Pitx1 (G-4) HRP

Sign In for Pricing
View Details
(5-Chloro-2,3-difluoro-4-methylphenyl) (methyl) sulfane
PC1018492-01 250 mg

(5-Chloro-2,3-difluoro-4-methylphenyl) (methyl) sulfane

Sign In for Pricing
View Details